General Information

  • ID:  hor000898
  • Uniprot ID:  Q810H5
  • Protein name:  Galanin-like peptide
  • Gene name:  GALP
  • Organism:  Mus musculus (Mouse)
  • Family:  Galanin family
  • Source:  Animal
  • Expression:  Isoform 2 is found in brain, thymus and skin. Isoform 2 is found in the skin, in pericytes covering microvascular arterioles and venules on their abluminal surfaces. In larger vessels, isoform 2 is expressed in layers of smooth muscle cells. Isoform 2 is
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0009725 response to hormone; GO:0032098 regulation of appetite; GO:0032868 response to insulin; GO:0035821 modulation of process of another organism; GO:0042595 behavioral response to starvation; GO:0042742 defense response to bacterium; GO:0050829 defense response to Gram-negative bacterium; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
  • GO CC:  GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence Information

  • Sequence:  APAHRGRGGWTLNSAGYLLGPVLPVSSKADQGRKRDSALEILDLWKIIDGLPYSHSPRMT
  • Length:  60(24-83)
  • Propeptide:  MACSVHLVLFLTILLSLAETPESAPAHRGRGGWTLNSAGYLLGPVLPVSSKADQGRKRDSALEILDLWKIIDGLPYSHSPRMTKRTMGETFVKANTGDMHILDKNVPKEEATLDSES
  • Signal peptide:  MACSVHLVLFLTILLSLAETPES
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin-releasing hormone secretion
  • Mechanism:  [Isoform 2]: Cleavage of the signal peptide generates a peptide of 25 amino acids, termed alarin because of the N-terminal alanine and the C-terminal serine. Vasoactive peptide.
  • Cross BBB:  NA
  • Target:  Galr2, Galr1
  • Target Unid:  O88854, P56479
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q810H5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000898_AF2.pdbhor000898_ESM.pdb

Physical Information

Mass: 758004 Formula: C291H464N86O83S
Absent amino acids: CF Common amino acids: LG
pI: 10.32 Basic residues: 10
Polar residues: 18 Hydrophobic residues: 20
Hydrophobicity: -38.83 Boman Index: -9542
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 89.5
Instability Index: 4986.83 Extinction Coefficient cystines: 13980
Absorbance 280nm: 236.95

Literature

  • PubMed ID:  NA
  • Title:  NA